SCOPe 2.05: Domain d3f6da1: 3f6d A:1-90

Lineage for d3f6da1 (3f6d A:1-90)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Anopheles dirus [TaxId:7168] [226778] (2 PDB entries)

8. Domain d3f6da1: 3f6d A:1-90 [209808]
   Other proteins in same PDB: d3f6da2, d3f6db2
   automated match to d1r5aa2
   complexed with gtx

Details for d3f6da1

PDB Entry: 3f6d, 1.7 Å

PDB Description: crystal structure of a genetically modified delta class gst (adgstd4- 4) from anopheles dirus, f123a, in complex with s-hexyl glutathione

PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f6da1:

Sequence; same for both SEQRES and ATOM records:

>d3f6da1 c.47.1.0 (A:1-90) automated matches {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Timeline for d3f6da1:

• d3f6da1 first appeared in SCOPe 2.03
  
• d3f6da1 appears in SCOPe 2.04
  
• d3f6da1 appears in SCOPe 2.06
  
• d3f6da1 appears in the current release, SCOPe 2.08