Lineage for d3f6da2 (3f6d A:91-218)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736436Species Anopheles dirus [TaxId:7168] [226779] (2 PDB entries)
  8. 1736437Domain d3f6da2: 3f6d A:91-218 [209809]
    Other proteins in same PDB: d3f6da1, d3f6db1
    automated match to d1r5aa1
    complexed with gtx

Details for d3f6da2

PDB Entry: 3f6d (more details), 1.7 Å

PDB Description: crystal structure of a genetically modified delta class gst (adgstd4- 4) from anopheles dirus, f123a, in complex with s-hexyl glutathione
PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6da2 a.45.1.0 (A:91-218) automated matches {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqiagqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryftq

SCOPe Domain Coordinates for d3f6da2:

Click to download the PDB-style file with coordinates for d3f6da2.
(The format of our PDB-style files is described here.)

Timeline for d3f6da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f6da1