Lineage for d3f2fb2 (3f2f B:81-205)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689616Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 1689617Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 1689623Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 1689624Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 1689625Species Escherichia coli [TaxId:562] [160393] (7 PDB entries)
    Uniprot P77072 81-212
  8. 1689635Domain d3f2fb2: 3f2f B:81-205 [209775]
    Other proteins in same PDB: d3f2fa1, d3f2fb1
    automated match to d1s6la2
    complexed with br, hg

Details for d3f2fb2

PDB Entry: 3f2f (more details), 1.98 Å

PDB Description: Crystal structure of the mercury-bound form of MerB, the Organomercurial Lyase involved in a bacterial mercury resistance system
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2fb2:

Sequence, based on SEQRES records: (download)

>d3f2fb2 d.357.1.2 (B:81-205) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllq

Sequence, based on observed residues (ATOM records): (download)

>d3f2fb2 d.357.1.2 (B:81-205) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefnrhl
lq

SCOPe Domain Coordinates for d3f2fb2:

Click to download the PDB-style file with coordinates for d3f2fb2.
(The format of our PDB-style files is described here.)

Timeline for d3f2fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f2fb1