Lineage for d3eyvb1 (3eyv B:1-119)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353666Species Engineered (including hybrid species) [88533] (63 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2353703Domain d3eyvb1: 3eyv B:1-119 [209745]
    Other proteins in same PDB: d3eyva2, d3eyvb2, d3eyvh2, d3eyvl2
    automated match to d1s3kh1
    complexed with gol, zn

Details for d3eyvb1

PDB Entry: 3eyv (more details), 2.5 Å

PDB Description: anti-lewis y fab fragment with lewis y antigen in the presence of zinc ions
PDB Compounds: (B:) hu3S193 Fab, heavy chain

SCOPe Domain Sequences for d3eyvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eyvb1 b.1.1.1 (B:1-119) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvss

SCOPe Domain Coordinates for d3eyvb1:

Click to download the PDB-style file with coordinates for d3eyvb1.
(The format of our PDB-style files is described here.)

Timeline for d3eyvb1: