| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
| Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
| Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries) |
| Domain d3evkc2: 3evk C:104-222 [209680] Other proteins in same PDB: d3evka1, d3evkb1, d3evkc1, d3evkd1 automated match to d1p7ga2 complexed with mn |
PDB Entry: 3evk (more details), 1.85 Å
SCOPe Domain Sequences for d3evkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3evkc2 d.44.1.1 (C:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl
Timeline for d3evkc2: