Lineage for d3evka2 (3evk A:104-222)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903585Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1903613Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 1903667Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)
  8. 1903692Domain d3evka2: 3evk A:104-222 [209676]
    Other proteins in same PDB: d3evka1, d3evkb1, d3evkc1, d3evkd1
    automated match to d1p7ga2
    complexed with mn

Details for d3evka2

PDB Entry: 3evk (more details), 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evka2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

SCOPe Domain Coordinates for d3evka2:

Click to download the PDB-style file with coordinates for d3evka2.
(The format of our PDB-style files is described here.)

Timeline for d3evka2: