Lineage for d3euub_ (3euu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753637Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2753651Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2753654Domain d3euub_: 3euu B: [209674]
    automated match to d3dara1

Details for d3euub_

PDB Entry: 3euu (more details), 2.34 Å

PDB Description: Crystal structure of the FGFR2 D2 domain
PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3euub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3euub_ b.1.1.4 (B:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

SCOPe Domain Coordinates for d3euub_:

Click to download the PDB-style file with coordinates for d3euub_.
(The format of our PDB-style files is described here.)

Timeline for d3euub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3euua_