| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
| Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
| Domain d3euub_: 3euu B: [209674] automated match to d3dara1 |
PDB Entry: 3euu (more details), 2.34 Å
SCOPe Domain Sequences for d3euub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3euub_ b.1.1.4 (B:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
Timeline for d3euub_: