Lineage for d3etga1 (3etg A:1-208)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143053Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2143191Protein automated matches [227004] (2 species)
    not a true protein
  7. 2143199Species Cow (Bos taurus) [TaxId:9913] [225673] (3 PDB entries)
  8. 2143206Domain d3etga1: 3etg A:1-208 [209651]
    Other proteins in same PDB: d3etga2, d3etgb2, d3etgc2, d3etgd2, d3etge2, d3etgf2
    automated match to d1l1fa2
    complexed with glu, gtp, gwd, ndp

Details for d3etga1

PDB Entry: 3etg (more details), 2.5 Å

PDB Description: glutamate dehydrogenase complexed with gw5074
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etga1 c.58.1.1 (A:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d3etga1:

Click to download the PDB-style file with coordinates for d3etga1.
(The format of our PDB-style files is described here.)

Timeline for d3etga1: