Lineage for d3eina1 (3ein A:2-85)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134304Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (8 PDB entries)
  8. 2134305Domain d3eina1: 3ein A:2-85 [209504]
    Other proteins in same PDB: d3eina2
    automated match to d1jlva2
    complexed with gsh

Details for d3eina1

PDB Entry: 3ein (more details), 1.13 Å

PDB Description: delta class gst
PDB Compounds: (A:) Glutathione S-transferase 1-1

SCOPe Domain Sequences for d3eina1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eina1 c.47.1.0 (A:2-85) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vdfyylpgsspcrsvimtakavgvelnkkllnlqagehlkpeflkinpqhtiptlvdngf
alwesraiqvylvekygktdslyp

SCOPe Domain Coordinates for d3eina1:

Click to download the PDB-style file with coordinates for d3eina1.
(The format of our PDB-style files is described here.)

Timeline for d3eina1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eina2