SCOPe 2.06: Domain d3egga_: 3egg A:

Lineage for d3egga_ (3egg A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (5 PDB entries)
   Uniprot P37140 1-308

8. Domain d3egga_: 3egg A: [209499]
   automated match to d1s70a_
   complexed with gol, mes, mn

Details for d3egga_

PDB Entry: 3egg, 1.85 Å

PDB Description: crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3egga_:

Sequence; same for both SEQRES and ATOM records:

>d3egga_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

Timeline for d3egga_:

• d3egga_ first appeared in SCOPe 2.03
  
• d3egga_ appears in SCOPe 2.05
  
• d3egga_ appears in SCOPe 2.07
  
• d3egga_ appears in the current release, SCOPe 2.08