SCOPe 2.07: Domain d3eefa_: 3eef A:

Lineage for d3eefa_ (3eef A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (25 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [225522] (1 PDB entry)

8. Domain d3eefa_: 3eef A: [209466]
   automated match to d1j2ra_
   complexed with zn

Details for d3eefa_

PDB Entry: 3eef, 2.35 Å

PDB Description: crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum

PDB Compounds: (A:) N-carbamoylsarcosine amidase related protein

SCOPe Domain Sequences for d3eefa_:

Sequence; same for both SEQRES and ATOM records:

>d3eefa_ c.33.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mkpalvvvdmvnefihgrlatpeamktvgparkvietfrrsglpvvyvndshypddpeir
iwgrhsmkgddgsevideirpsagdyvlekhaysgfygtnldmilrangidtvvliglda
dicvrhtaadalyrnyriivvedavaaridpnwkdyftrvygatvkrsdeieg

Timeline for d3eefa_:

• d3eefa_ first appeared in SCOPe 2.03
  
• d3eefa_ appears in SCOPe 2.06
  
• d3eefa_ appears in the current release, SCOPe 2.08