![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
![]() | Protein automated matches [190491] (18 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225536] (1 PDB entry) |
![]() | Domain d3ednb1: 3edn B:1-131 [209464] automated match to d1qy9a1 complexed with mg, sin, so4 |
PDB Entry: 3edn (more details), 1.5 Å
SCOPe Domain Sequences for d3ednb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ednb1 d.21.1.0 (B:1-131) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mktinvfhydaftnkpnmgnpagivldadglteeemqriaekvgfnetsfvlssevadir mryftpgyemdlcghgtvgtiyalrerglleekasltietkagilpiqigvnengetfik mrqtapqfkdf
Timeline for d3ednb1: