SCOPe 2.08: Domain d3ednb1: 3edn B:1-131

Lineage for d3ednb1 (3edn B:1-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225536] (1 PDB entry)

8. Domain d3ednb1: 3edn B:1-131 [209464]
   automated match to d1qy9a1
   complexed with mg, sin, so4

Details for d3ednb1

PDB Entry: 3edn, 1.5 Å

PDB Description: Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family

PDB Compounds: (B:) Phenazine biosynthesis protein, PhzF family

SCOPe Domain Sequences for d3ednb1:

Sequence; same for both SEQRES and ATOM records:

>d3ednb1 d.21.1.0 (B:1-131) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktinvfhydaftnkpnmgnpagivldadglteeemqriaekvgfnetsfvlssevadir
mryftpgyemdlcghgtvgtiyalrerglleekasltietkagilpiqigvnengetfik
mrqtapqfkdf

Timeline for d3ednb1:

• d3ednb1 first appeared in SCOPe 2.03
  
• d3ednb1 appears in SCOPe 2.07