Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species) |
Species Staphylococcus aureus [TaxId:1280] [225702] (1 PDB entry) |
Domain d3e2ia1: 3e2i A:7-142 [209362] Other proteins in same PDB: d3e2ia2 automated match to d1xx6a1 complexed with gol, zn |
PDB Entry: 3e2i (more details), 2.01 Å
SCOPe Domain Sequences for d3e2ia1:
Sequence, based on SEQRES records: (download)
>d3e2ia1 c.37.1.24 (A:7-142) Thymidine kinase, TK1, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} sgwiecitgsmfsgkseelirrlrrgiyakqkvvvfkpaiddryhkekvvshngnaieai niskaseimthdltnvdvigidevqffddeivsiveklsadghrvivagldmdfrgepfe pmpklmavseqvtklq
>d3e2ia1 c.37.1.24 (A:7-142) Thymidine kinase, TK1, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} sgwiecitgsmfsgkseelirrlrrgiyakqkvvvfkpashngnaieainiskaseimth dltnvdvigidevqffddeivsiveklsadghrvivagldmdfrgepfepmpklmavseq vtklq
Timeline for d3e2ia1: