Lineage for d3e2ia1 (3e2i A:7-142)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479540Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 2479541Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 2479556Species Staphylococcus aureus [TaxId:1280] [225702] (1 PDB entry)
  8. 2479557Domain d3e2ia1: 3e2i A:7-142 [209362]
    Other proteins in same PDB: d3e2ia2
    automated match to d1xx6a1
    complexed with gol, zn

Details for d3e2ia1

PDB Entry: 3e2i (more details), 2.01 Å

PDB Description: crystal structure of thymidine kinase from s. aureus
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d3e2ia1:

Sequence, based on SEQRES records: (download)

>d3e2ia1 c.37.1.24 (A:7-142) Thymidine kinase, TK1, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
sgwiecitgsmfsgkseelirrlrrgiyakqkvvvfkpaiddryhkekvvshngnaieai
niskaseimthdltnvdvigidevqffddeivsiveklsadghrvivagldmdfrgepfe
pmpklmavseqvtklq

Sequence, based on observed residues (ATOM records): (download)

>d3e2ia1 c.37.1.24 (A:7-142) Thymidine kinase, TK1, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
sgwiecitgsmfsgkseelirrlrrgiyakqkvvvfkpashngnaieainiskaseimth
dltnvdvigidevqffddeivsiveklsadghrvivagldmdfrgepfepmpklmavseq
vtklq

SCOPe Domain Coordinates for d3e2ia1:

Click to download the PDB-style file with coordinates for d3e2ia1.
(The format of our PDB-style files is described here.)

Timeline for d3e2ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e2ia2