Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains |
Protein Golgi alpha-mannosidase II [88657] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries) Uniprot Q24451 94-1107 |
Domain d3dx4a3: 3dx4 A:523-1045 [209343] Other proteins in same PDB: d3dx4a1, d3dx4a2 automated match to d1qwna2 complexed with goo, mrd, nag, zn |
PDB Entry: 3dx4 (more details), 1.38 Å
SCOPe Domain Sequences for d3dx4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dx4a3 b.30.5.6 (A:523-1045) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl lpnvarcerttltflqnlehldgmvapevcpmetaayvsshss
Timeline for d3dx4a3: