SCOPe 2.07: Domain d3dt4c1: 3dt4 C:3-259

Lineage for d3dt4c1 (3dt4 C:3-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)

8. Domain d3dt4c1: 3dt4 C:3-259 [209294]
   Other proteins in same PDB: d3dt4a2, d3dt4c2
   automated match to d1khba2
   complexed with 1pe, gtp, mn, na, oxl

Details for d3dt4c1

PDB Entry: 3dt4, 1.45 Å

PDB Description: the structure of rat cytosolic pepck in complex with oxalate and gtp

PDB Compounds: (C:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d3dt4c1:

Sequence; same for both SEQRES and ATOM records:

>d3dt4c1 c.109.1.1 (C:3-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqe
egvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedf
ekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvle
algdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllg
kkcfalriasrlakeeg

Timeline for d3dt4c1:

• d3dt4c1 first appeared in SCOPe 2.03
  
• d3dt4c1 appears in SCOPe 2.06
  
• d3dt4c1 appears in the current release, SCOPe 2.08