| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
| Protein HIV capsid protein, dimerisation domain [47359] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (14 PDB entries) |
| Domain d3ds5b_: 3ds5 B: [209286] automated match to d1baja_ mutant |
PDB Entry: 3ds5 (more details), 2.4 Å
SCOPe Domain Sequences for d3ds5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ds5b_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sildirqgpkepfrdyvdrfyktlraeqasqevkawmtetllvqnanpdcktilkalgpg
atleemmtacqgv
Timeline for d3ds5b_: