Lineage for d3dpda3 (3dpd A:525-725)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745301Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1745302Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1745303Species Human (Homo sapiens) [TaxId:9606] [48402] (58 PDB entries)
  8. 1745348Domain d3dpda3: 3dpd A:525-725 [209252]
    Other proteins in same PDB: d3dpda1, d3dpda2, d3dpda4
    automated match to d1e8ya1
    complexed with 41a

Details for d3dpda3

PDB Entry: 3dpd (more details), 2.85 Å

PDB Description: Achieving multi-isoform PI3K inhibition in a series of substituted 3,4-Dihydro-2H-benzo[1,4]oxazines
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3dpda3:

Sequence, based on SEQRES records: (download)

>d3dpda3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3dpda3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
eaylrgcg

SCOPe Domain Coordinates for d3dpda3:

Click to download the PDB-style file with coordinates for d3dpda3.
(The format of our PDB-style files is described here.)

Timeline for d3dpda3: