Lineage for d3djck2 (3djc K:123-255)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606329Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry)
  8. 1606351Domain d3djck2: 3djc K:123-255 [209203]
    automated match to d3bexa2
    complexed with gol

Details for d3djck2

PDB Entry: 3djc (more details), 2.4 Å

PDB Description: crystal structure of pantothenate kinase from legionella pneumophila
PDB Compounds: (K:) Type III pantothenate kinase

SCOPe Domain Sequences for d3djck2:

Sequence, based on SEQRES records: (download)

>d3djck2 c.55.1.0 (K:123-255) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntaklpsveiiktesvvgr
stiesiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdl
vlqgirlaammnt

Sequence, based on observed residues (ATOM records): (download)

>d3djck2 c.55.1.0 (K:123-255) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntaveiktesvvgrsties
iqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdlvlqgi
rlaammnt

SCOPe Domain Coordinates for d3djck2:

Click to download the PDB-style file with coordinates for d3djck2.
(The format of our PDB-style files is described here.)

Timeline for d3djck2: