Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189959] (12 PDB entries) |
Domain d3dj3c_: 3dj3 C: [209178] automated match to d2egna_ |
PDB Entry: 3dj3 (more details), 2.4 Å
SCOPe Domain Sequences for d3dj3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dj3c_ b.36.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiagl qigdkimqvngwdmtmvthdqarkrltkrseevvrllvtr
Timeline for d3dj3c_: