Lineage for d3dg7b2 (3dg7 B:125-366)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344241Species Mycobacterium smegmatis [TaxId:246196] [225618] (4 PDB entries)
  8. 1344246Domain d3dg7b2: 3dg7 B:125-366 [209165]
    Other proteins in same PDB: d3dg7a1, d3dg7b1, d3dg7c1, d3dg7d1
    automated match to d1nu5a1
    complexed with mg, muc

Details for d3dg7b2

PDB Entry: 3dg7 (more details), 2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dg7b2 c.1.11.0 (B:125-366) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ytdrmrvshmlgfddpvkmvaeaeriretygintfkvkvgrrpvqldtavvralrerfgd
aielyvdgnrgwsaaeslramremadldllfaeelcpaddvlsrrrlvgqldmpfiades
vptpadvtrevlggsataisiktartgftgstrvhhlaeglgldmvmgnqidgqigtact
vsfgtafertsrhagelsnfldmsddlltvplqisdgqlhrrpgpglgieidpdklahyr
td

SCOPe Domain Coordinates for d3dg7b2:

Click to download the PDB-style file with coordinates for d3dg7b2.
(The format of our PDB-style files is described here.)

Timeline for d3dg7b2: