| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [225617] (4 PDB entries) |
| Domain d3dg7a1: 3dg7 A:1-124 [209162] Other proteins in same PDB: d3dg7a2, d3dg7b2, d3dg7c2, d3dg7d2 automated match to d1nu5a2 complexed with mg, muc |
PDB Entry: 3dg7 (more details), 2 Å
SCOPe Domain Sequences for d3dg7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dg7a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg
Timeline for d3dg7a1: