SCOPe 2.08: Domain d3dd3a1: 3dd3 A:0-76

Lineage for d3dd3a1 (3dd3 A:0-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d3dd3a1: 3dd3 A:0-76 [209089]
   Other proteins in same PDB: d3dd3a2, d3dd3b2
   automated match to d13gsa2
   complexed with gsh, mes, ruc

Details for d3dd3a1

PDB Entry: 3dd3, 2.25 Å

PDB Description: Crystal Structure of the Glutathione Transferase Pi enzyme in complex with the bifunctional inhibitor, Etharapta

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3dd3a1:

Sequence; same for both SEQRES and ATOM records:

>d3dd3a1 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

Timeline for d3dd3a1:

• d3dd3a1 first appeared in SCOPe 2.03
  
• d3dd3a1 appears in SCOPe 2.07