SCOPe 2.04: Domain d3daia_: 3dai A:

Lineage for d3daia_ (3dai A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)

8. Domain d3daia_: 3dai A: [209058]
   automated match to d3d7ca_
   complexed with cl, so4

Details for d3daia_

PDB Entry: 3dai, 1.95 Å

PDB Description: crystal structure of the bromodomain of the human atad2

PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d3daia_:

Sequence; same for both SEQRES and ATOM records:

>d3daia_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr

Timeline for d3daia_:

• d3daia_ first appeared in SCOPe 2.03
  
• d3daia_ appears in SCOPe 2.05
  
• d3daia_ appears in the current release, SCOPe 2.08, called d3daia1