Lineage for d3d6bd2 (3d6b D:243-393)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321679Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2321680Protein automated matches [226935] (30 species)
    not a true protein
  7. 2321728Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)
  8. 2321744Domain d3d6bd2: 3d6b D:243-393 [209024]
    Other proteins in same PDB: d3d6ba1, d3d6bb1, d3d6bc1, d3d6bd1
    automated match to d1siqa1
    complexed with 54d

Details for d3d6bd2

PDB Entry: 3d6b (more details), 2.21 Å

PDB Description: 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3d6bd2:

Sequence, based on SEQRES records: (download)

>d3d6bd2 a.29.3.0 (D:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqa

Sequence, based on observed residues (ATOM records): (download)

>d3d6bd2 a.29.3.0 (D:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngvarhlvnle
vvntyehdihalilgraqtgiqa

SCOPe Domain Coordinates for d3d6bd2:

Click to download the PDB-style file with coordinates for d3d6bd2.
(The format of our PDB-style files is described here.)

Timeline for d3d6bd2: