![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (19 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries) |
![]() | Domain d3d5xa_: 3d5x A: [209013] automated match to d2jamb_ complexed with kwt |
PDB Entry: 3d5x (more details), 2.8 Å
SCOPe Domain Sequences for d3d5xa_:
Sequence, based on SEQRES records: (download)
>d3d5xa_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkkdlcgtpny iapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpv asalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvpp
>d3d5xa_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkkdiapevlc kkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpvasalirr mlhadptlrpsvaelltdefftsgyapmrlptscltvpp
Timeline for d3d5xa_: