Lineage for d3d22a1 (3d22 A:24-139)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134888Species Populus trichocarpa [TaxId:3695] [187360] (4 PDB entries)
  8. 2134889Domain d3d22a1: 3d22 A:24-139 [208987]
    automated match to d2vm1c_
    complexed with po4; mutant

Details for d3d22a1

PDB Entry: 3d22 (more details), 1.6 Å

PDB Description: crystal structure of a poplar thioredoxin h mutant, pttrxh4c61s
PDB Compounds: (A:) Thioredoxin H-type

SCOPe Domain Sequences for d3d22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d22a1 c.47.1.0 (A:24-139) automated matches {Populus trichocarpa [TaxId: 3695]}
gnvhlittkerwdqklseasrdgkivlanfsarwcgpsrqiapyyielsenypslmflvi
dvdelsdfsasweikatptffflrdgqqvdklvgankpelhkkitaildslppsdk

SCOPe Domain Coordinates for d3d22a1:

Click to download the PDB-style file with coordinates for d3d22a1.
(The format of our PDB-style files is described here.)

Timeline for d3d22a1: