Lineage for d3d0oa2 (3d0o A:149-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939389Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)
  8. 1939392Domain d3d0oa2: 3d0o A:149-312 [208980]
    Other proteins in same PDB: d3d0oa1, d3d0ob1
    automated match to d2ldba2

Details for d3d0oa2

PDB Entry: 3d0o (more details), 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase from staphylococcus aureus
PDB Compounds: (A:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3d0oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0oa2 d.162.1.0 (A:149-312) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimae

SCOPe Domain Coordinates for d3d0oa2:

Click to download the PDB-style file with coordinates for d3d0oa2.
(The format of our PDB-style files is described here.)

Timeline for d3d0oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d0oa1