SCOPe 2.03: Domain d3d0oa2: 3d0o A:149-312

Lineage for d3d0oa2 (3d0o A:149-312)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (21 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)

8. Domain d3d0oa2: 3d0o A:149-312 [208980]
   Other proteins in same PDB: d3d0oa1, d3d0ob1
   automated match to d2ldba2

Details for d3d0oa2

PDB Entry: 3d0o, 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase from staphylococcus aureus

PDB Compounds: (A:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3d0oa2:

Sequence; same for both SEQRES and ATOM records:

>d3d0oa2 d.162.1.0 (A:149-312) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimae

Timeline for d3d0oa2:

• d3d0oa2 is new in SCOPe 2.03-stable
  
• d3d0oa2 appears in SCOPe 2.04
  
• d3d0oa2 appears in the current release, SCOPe 2.08