Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (21 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries) |
Domain d3d0oa2: 3d0o A:149-312 [208980] Other proteins in same PDB: d3d0oa1, d3d0ob1 automated match to d2ldba2 |
PDB Entry: 3d0o (more details), 1.8 Å
SCOPe Domain Sequences for d3d0oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0oa2 d.162.1.0 (A:149-312) automated matches {Staphylococcus aureus [TaxId: 93062]} tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimae
Timeline for d3d0oa2: