Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (21 species) not a true protein |
Species Myxococcus xanthus [TaxId:246197] [225452] (1 PDB entry) |
Domain d3cwva1: 3cwv A:8-206 [208972] Other proteins in same PDB: d3cwva2, d3cwvb2 automated match to d1ei1a2 |
PDB Entry: 3cwv (more details), 1.95 Å
SCOPe Domain Sequences for d3cwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cwva1 d.122.1.0 (A:8-206) automated matches {Myxococcus xanthus [TaxId: 246197]} ggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfc tsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmge hghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapgl rvsfadlqrgertlwhlpg
Timeline for d3cwva1: