![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (19 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [189174] (6 PDB entries) |
![]() | Domain d3cwna_: 3cwn A: [208970] automated match to d1f05a_ complexed with so4; mutant |
PDB Entry: 3cwn (more details), 1.4 Å
SCOPe Domain Sequences for d3cwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cwna_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 562]} tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispyvgr ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr ltiaptllkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk faidqeklekmigdll
Timeline for d3cwna_: