![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (309 species) not a true protein |
![]() | Species Eubacterium barkeri [TaxId:1528] [225505] (1 PDB entry) |
![]() | Domain d3ckya1: 3cky A:4-166 [208890] Other proteins in same PDB: d3ckya2, d3ckyb2, d3ckyc2, d3ckyd2 automated match to d2cvza2 |
PDB Entry: 3cky (more details), 2.3 Å
SCOPe Domain Sequences for d3ckya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ckya1 c.2.1.0 (A:4-166) automated matches {Eubacterium barkeri [TaxId: 1528]} sikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdi iftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdap vsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgd
Timeline for d3ckya1: