Lineage for d3ck1b1 (3ck1 B:1-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944388Species Cupriavidus necator [TaxId:264198] [225431] (1 PDB entry)
  8. 2944390Domain d3ck1b1: 3ck1 B:1-142 [208887]
    Other proteins in same PDB: d3ck1a2, d3ck1b2
    automated match to d1s5ug_
    complexed with cl, gol

Details for d3ck1b1

PDB Entry: 3ck1 (more details), 1.74 Å

PDB Description: crystal structure of a putative thioesterase (reut_a2179) from ralstonia eutropha jmp134 at 1.74 a resolution
PDB Compounds: (B:) Putative thioesterase

SCOPe Domain Sequences for d3ck1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ck1b1 d.38.1.0 (B:1-142) automated matches {Cupriavidus necator [TaxId: 264198]}
mtavfrntvlvrfkhcdaagivfypryfemlndfiedwfaqaldwpfdamhgagqagvpt
adlhcrfvapsrlgetltrelrvvklgqssftvqvrfmgpdsglrlevtqrlvcvdtdki
aprplpdpvrqamatyvdetla

SCOPe Domain Coordinates for d3ck1b1:

Click to download the PDB-style file with coordinates for d3ck1b1.
(The format of our PDB-style files is described here.)

Timeline for d3ck1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ck1b2