Lineage for d3cfba1 (3cfb A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759502Domain d3cfba1: 3cfb A:1-107 [208861]
    Other proteins in same PDB: d3cfba2, d3cfbb_, d3cfbh_, d3cfbl2
    automated match to d1dqdl1
    complexed with gol, spb

Details for d3cfba1

PDB Entry: 3cfb (more details), 1.6 Å

PDB Description: High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene hapten at 100K
PDB Compounds: (A:) blue fluorescent antibody ep2-19g2-kappa light chain

SCOPe Domain Sequences for d3cfba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfba1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleik

SCOPe Domain Coordinates for d3cfba1:

Click to download the PDB-style file with coordinates for d3cfba1.
(The format of our PDB-style files is described here.)

Timeline for d3cfba1: