![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d3cfbl2: 3cfb L:108-213 [208864] Other proteins in same PDB: d3cfba1, d3cfbb_, d3cfbh_, d3cfbl1 automated match to d1dqdl2 complexed with gol, spb |
PDB Entry: 3cfb (more details), 1.6 Å
SCOPe Domain Sequences for d3cfbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfbl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d3cfbl2:
![]() Domains from other chains: (mouse over for more information) d3cfba1, d3cfba2, d3cfbb_, d3cfbh_ |