Lineage for d3ca0a1 (3ca0 A:1-128)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2062118Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2062119Protein automated matches [226913] (9 species)
    not a true protein
  7. 2062189Species Sambucus nigra [TaxId:4202] [225559] (8 PDB entries)
  8. 2062204Domain d3ca0a1: 3ca0 A:1-128 [208823]
    automated match to d1onkb1
    complexed with act, so4

Details for d3ca0a1

PDB Entry: 3ca0 (more details), 1.95 Å

PDB Description: sambucus nigra agglutinin ii (sna-ii), hexagonal crystal form
PDB Compounds: (A:) Agglutinin II

SCOPe Domain Sequences for d3ca0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ca0a1 b.42.2.0 (A:1-128) automated matches {Sambucus nigra [TaxId: 4202]}
tsftrnivgrdglcvdvrngydtdgtplqlwpcgtqrnqrwtfdsddtirsmgkcmtang
lnngsnivifncstaaenaikwevpidgsiinpssglvmtapraasrtillledniyaas
qgwtvtnn

SCOPe Domain Coordinates for d3ca0a1:

Click to download the PDB-style file with coordinates for d3ca0a1.
(The format of our PDB-style files is described here.)

Timeline for d3ca0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ca0a2