Lineage for d3c6pa2 (3c6p A:101-160)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017816Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2017817Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2017854Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2017855Protein automated matches [226937] (1 species)
    not a true protein
  7. 2017856Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (6 PDB entries)
  8. 2017861Domain d3c6pa2: 3c6p A:101-160 [208805]
    Other proteins in same PDB: d3c6pa1
    automated match to d1p22b1
    complexed with 2s3, ihp

Details for d3c6pa2

PDB Entry: 3c6p (more details), 2.7 Å

PDB Description: small molecule agonists and antagonists of f-box protein-substrate interactions in auxin perception and signaling
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d3c6pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6pa2 a.157.1.0 (A:101-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe

SCOPe Domain Coordinates for d3c6pa2:

Click to download the PDB-style file with coordinates for d3c6pa2.
(The format of our PDB-style files is described here.)

Timeline for d3c6pa2: