![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (3 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (3 PDB entries) |
![]() | Domain d3c6pa1: 3c6p A:8-58 [208804] Other proteins in same PDB: d3c6pa2 automated match to d2ovra2 complexed with 2s3, ihp |
PDB Entry: 3c6p (more details), 2.7 Å
SCOPe Domain Sequences for d3c6pa1:
Sequence, based on SEQRES records: (download)
>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakviey
>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lkseavalesqtiaplpnvtskilakviey
Timeline for d3c6pa1: