Lineage for d3c6pa1 (3c6p A:8-58)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647603Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1647604Protein automated matches [190710] (3 species)
    not a true protein
  7. 1647655Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (3 PDB entries)
  8. 1647658Domain d3c6pa1: 3c6p A:8-58 [208804]
    Other proteins in same PDB: d3c6pa2
    automated match to d2ovra2
    complexed with 2s3, ihp

Details for d3c6pa1

PDB Entry: 3c6p (more details), 2.7 Å

PDB Description: small molecule agonists and antagonists of f-box protein-substrate interactions in auxin perception and signaling
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d3c6pa1:

Sequence, based on SEQRES records: (download)

>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakviey

Sequence, based on observed residues (ATOM records): (download)

>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkseavalesqtiaplpnvtskilakviey

SCOPe Domain Coordinates for d3c6pa1:

Click to download the PDB-style file with coordinates for d3c6pa1.
(The format of our PDB-style files is described here.)

Timeline for d3c6pa1: