Lineage for d3b8ax1 (3b8a X:15-224)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373365Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 1373378Domain d3b8ax1: 3b8a X:15-224 [208560]
    automated match to d1ig8a1
    complexed with bgc, so4

Details for d3b8ax1

PDB Entry: 3b8a (more details), 2.95 Å

PDB Description: crystal structure of yeast hexokinase pi in complex with glucose
PDB Compounds: (X:) Hexokinase-1

SCOPe Domain Sequences for d3b8ax1:

Sequence, based on SEQRES records: (download)

>d3b8ax1 c.55.1.0 (X:15-224) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smadvpkelmdeihqledmftvdsetlrkvvkhfidelnkgltkkggnipmipgwvmefp
tgkesgnylaidlggtnlrvvlvklsgnhtfdttqskyklphdmrttkhqeelwsfiads
lkdfmveqellntkdtlplgftfsypasqnkinegilqrwtkgfdipnveghdvvpllqn
eiskrelpieivalindtvgtliasyytdp

Sequence, based on observed residues (ATOM records): (download)

>d3b8ax1 c.55.1.0 (X:15-224) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smadvpkelmdeihqledmftvdsetlrkvvkhfidelnkgltkkggnipmipgwvmefp
tgkesgnylaidlggtnlrvvlvklsgnhtfdttqskyklphdmrttkhqeelwsfiads
lkdfmveqellntdtlplgftfsypasqnkinegilqrwtkgfdipnveghdvvpllqne
iskrelpieivalindtvgtliasyytdp

SCOPe Domain Coordinates for d3b8ax1:

Click to download the PDB-style file with coordinates for d3b8ax1.
(The format of our PDB-style files is described here.)

Timeline for d3b8ax1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b8ax2