SCOPe 2.08: Domain d3b8ax1: 3b8a X:15-224

Lineage for d3b8ax1 (3b8a X:15-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)

8. Domain d3b8ax1: 3b8a X:15-224 [208560]
   automated match to d1ig8a1
   complexed with bgc, so4

Details for d3b8ax1

PDB Entry: 3b8a, 2.95 Å

PDB Description: crystal structure of yeast hexokinase pi in complex with glucose

PDB Compounds: (X:) Hexokinase-1

SCOPe Domain Sequences for d3b8ax1:

Sequence, based on SEQRES records:

>d3b8ax1 c.55.1.0 (X:15-224) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smadvpkelmdeihqledmftvdsetlrkvvkhfidelnkgltkkggnipmipgwvmefp
tgkesgnylaidlggtnlrvvlvklsgnhtfdttqskyklphdmrttkhqeelwsfiads
lkdfmveqellntkdtlplgftfsypasqnkinegilqrwtkgfdipnveghdvvpllqn
eiskrelpieivalindtvgtliasyytdp

Sequence, based on observed residues (ATOM records):

>d3b8ax1 c.55.1.0 (X:15-224) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smadvpkelmdeihqledmftvdsetlrkvvkhfidelnkgltkkggnipmipgwvmefp
tgkesgnylaidlggtnlrvvlvklsgnhtfdttqskyklphdmrttkhqeelwsfiads
lkdfmveqellntdtlplgftfsypasqnkinegilqrwtkgfdipnveghdvvpllqne
iskrelpieivalindtvgtliasyytdp

Timeline for d3b8ax1:

• d3b8ax1 first appeared in SCOPe 2.03
  
• d3b8ax1 appears in SCOPe 2.07