Lineage for d3b5te_ (3b5t E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520432Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 1520442Domain d3b5te_: 3b5t E: [208540]
    automated match to d1cd0b_
    mutant

Details for d3b5te_

PDB Entry: 3b5t (more details), 1.75 Å

PDB Description: crystal structure of novel immune-type receptor 10 se-met extracellular fragment mutant n30d
PDB Compounds: (E:) Novel immune-type receptor 10

SCOPe Domain Sequences for d3b5te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5te_ b.1.1.0 (E:) automated matches {Ictalurus punctatus [TaxId: 7998]}
dikelhvktvkrgenvtmecsmskvkdknklawyrqsfgkvpqyfvryyssnsgykfaeg
fkdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf

SCOPe Domain Coordinates for d3b5te_:

Click to download the PDB-style file with coordinates for d3b5te_.
(The format of our PDB-style files is described here.)

Timeline for d3b5te_: