SCOP 1.61: Domain d1ddha1: 1ddh A:182-274

Lineage for d1ddha1 (1ddh A:182-274)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [48963] (3 PDB entries)

8. Domain d1ddha1: 1ddh A:182-274 [20845]
   Other proteins in same PDB: d1ddha2

Details for d1ddha1

PDB Entry: 1ddh, 3.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120

SCOP Domain Sequences for d1ddha1:

Sequence; same for both SEQRES and ATOM records:

>d1ddha1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DD}
tdppkahvthhrrpegdvtlrcwalgfypaeitltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkqqkytchveheglpepltlrw

Timeline for d1ddha1:

• d1ddha1 first appeared (with stable ids) in SCOP 1.55
  
• d1ddha1 appears in SCOP 1.59
  
• d1ddha1 appears in SCOP 1.63
  
• d1ddha1 appears in the current release, SCOPe 2.08