Lineage for d3arna_ (3arn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427749Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries)
  8. 2427760Domain d3arna_: 3arn A: [208351]
    automated match to d4apza_
    complexed with mg, msj

Details for d3arna_

PDB Entry: 3arn (more details), 1.8 Å

PDB Description: human dutpase in complex with novel uracil derivative
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3arna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arna_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqal

SCOPe Domain Coordinates for d3arna_:

Click to download the PDB-style file with coordinates for d3arna_.
(The format of our PDB-style files is described here.)

Timeline for d3arna_: