SCOPe 2.07: Domain d3araa_: 3ara A:

Lineage for d3araa_ (3ara A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries)

8. Domain d3araa_: 3ara A: [208345]
   automated match to d4apza_
   complexed with mg, mkh

Details for d3araa_

PDB Entry: 3ara, 1.7 Å

PDB Description: discovery of novel uracil derivatives as potent human dutpase inhibitors

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3araa_:

Sequence; same for both SEQRES and ATOM records:

>d3araa_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqal

Timeline for d3araa_:

• d3araa_ first appeared in SCOPe 2.03
  
• d3araa_ appears in SCOPe 2.06
  
• d3araa_ appears in the current release, SCOPe 2.08