Lineage for d3amzb3 (3amz B:192-414)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593796Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2593834Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2593835Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2593841Domain d3amzb3: 3amz B:192-414 [208280]
    Other proteins in same PDB: d3amza1, d3amza2, d3amza4, d3amza5, d3amza6, d3amzb1, d3amzb2, d3amzb4, d3amzb5, d3amzb6
    automated match to d1v97a6
    complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc

Details for d3amzb3

PDB Entry: 3amz (more details), 2.1 Å

PDB Description: Bovine Xanthine Oxidoreductase urate bound form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3amzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amzb3 d.145.1.3 (B:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d3amzb3:

Click to download the PDB-style file with coordinates for d3amzb3.
(The format of our PDB-style files is described here.)

Timeline for d3amzb3: