Lineage for d3aima_ (3aim A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903089Species Sulfolobus tokodaii [TaxId:111955] [226148] (5 PDB entries)
  8. 2903106Domain d3aima_: 3aim A: [208229]
    automated match to d1evqa_
    complexed with mpd, mrd, po4; mutant

Details for d3aima_

PDB Entry: 3aim (more details), 2.3 Å

PDB Description: R267E mutant of a HSL-like carboxylesterase from Sulfolobus tokodaii
PDB Compounds: (A:) 303aa long hypothetical esterase

SCOPe Domain Sequences for d3aima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aima_ c.69.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
asveeirslfkqfssltpreevgkieditipgsetnikarvyypktqgpygvlvyyhggg
fvlgdiesydplcraitnscqcvtisvdyrlapenkfpaavvdsfdalkwvynnsekfng
kygiavggdsaggnlaavtailskkeniklkyqvliypavsfdlitkslydngegffltr
ehidwfgqqylrsfadlldfrfspiladlndlppaliitaehdplrdqgeayankllqsg
vqvtsvefnnvihgfvsffpfieqgrdaigligyvlrkvfygk

SCOPe Domain Coordinates for d3aima_:

Click to download the PDB-style file with coordinates for d3aima_.
(The format of our PDB-style files is described here.)

Timeline for d3aima_: