Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
Protein Carboxylesterase [53488] (3 species) bacterial homologue of human hormone sensitive lipase |
Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries) Uniprot Q7SIG1 |
Domain d1evqa_: 1evq A: [34635] complexed with epe, trs |
PDB Entry: 1evq (more details), 2.6 Å
SCOPe Domain Sequences for d1evqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evqa_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli ypstgydpahppasieenaegylltggmmlwfrdqylnsleelthpwfspvlypdlsglp payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria eklrdala
Timeline for d1evqa_: