PDB entry 1evq

View 1evq on RCSB PDB site
Description: the crystal structure of the thermophilic carboxylesterase est2 from alicyclobacillus acidocaldarius
Class: hydrolase
Keywords: alpha/beta hydrolase fold
Deposited on 2000-04-20, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydrolase
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evqa_
  • Heterogens: EPE, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evqA (A:)
    mpldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtl
    kvrmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehk
    fpaavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafql
    liypstgydpahppasieenaegylltggmmlwfrdqylnsleelthpwfspvlypdlsg
    lppayiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvr
    iaeklrdala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evqA (A:)
    ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
    rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
    aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
    ypstgydpahppasieenaegylltggmmlwfrdqylnsleelthpwfspvlypdlsglp
    payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
    eklrdala