SCOPe 2.04: Domain d3agxa1: 3agx A:165-245

Lineage for d3agxa1 (3agx A:165-245)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)

8. Domain d3agxa1: 3agx A:165-245 [208209]
   automated match to d1c3ga1

Details for d3agxa1

PDB Entry: 3agx, 1.85 Å

PDB Description: Crystal structure of human Hsp40 Hdj1 peptide-binding domain

PDB Compounds: (A:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d3agxa1:

Sequence; same for both SEQRES and ATOM records:

>d3agxa1 b.4.1.0 (A:165-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfpkeg
dqtsnnipadivfvlkdkphn

Timeline for d3agxa1:

• d3agxa1 first appeared in SCOPe 2.03
  
• d3agxa1 appears in SCOPe 2.05
  
• d3agxa1 appears in the current release, SCOPe 2.08