Class b: All beta proteins [48724] (176 folds) |
Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) |
Family b.4.1.0: automated matches [227209] (1 protein) not a true family |
Protein automated matches [226943] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries) |
Domain d3agxa1: 3agx A:165-245 [208209] automated match to d1c3ga1 |
PDB Entry: 3agx (more details), 1.85 Å
SCOPe Domain Sequences for d3agxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agxa1 b.4.1.0 (A:165-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} thdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfpkeg dqtsnnipadivfvlkdkphn
Timeline for d3agxa1: