SCOPe 2.03: Domain d3ab3c1: 3ab3 C:47-75,C:202-368

Lineage for d3ab3c1 (3ab3 C:47-75,C:202-368)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
   Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372

8. Domain d3ab3c1: 3ab3 C:47-75,C:202-368 [208194]
   Other proteins in same PDB: d3ab3a2, d3ab3c2
   automated match to d1zcba2
   complexed with alf, gdp, mg

Details for d3ab3c1

PDB Entry: 3ab3, 2.4 Å

PDB Description: crystal structure of p115rhogef rgs domain in complex with g alpha 13

PDB Compounds: (C:) Guanine nucleotide-binding protein G(k) subunit alpha, Guanine nucleotide-binding protein subunit alpha-13

SCOPe Domain Sequences for d3ab3c1:

Sequence, based on SEQRES records:

>d3ab3c1 c.37.1.8 (C:47-75,C:202-368) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk
rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln
ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqqrplyhhfttain
tenirlvfrdvkdtilh

Sequence, based on observed residues (ATOM records):

>d3ab3c1 c.37.1.8 (C:47-75,C:202-368) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk
rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln
ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdplyhhfttainteni
rlvfrdvkdtilh

Timeline for d3ab3c1:

• d3ab3c1 is new in SCOPe 2.03-stable
  
• d3ab3c1 appears in SCOPe 2.04
  
• d3ab3c1 appears in the current release, SCOPe 2.08