Lineage for d3ab3c1 (3ab3 C:47-75,C:202-368)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363685Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1363725Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 1363728Domain d3ab3c1: 3ab3 C:47-75,C:202-368 [208194]
    Other proteins in same PDB: d3ab3a2, d3ab3c2
    automated match to d1zcba2
    complexed with alf, gdp, mg

Details for d3ab3c1

PDB Entry: 3ab3 (more details), 2.4 Å

PDB Description: crystal structure of p115rhogef rgs domain in complex with g alpha 13
PDB Compounds: (C:) Guanine nucleotide-binding protein G(k) subunit alpha, Guanine nucleotide-binding protein subunit alpha-13

SCOPe Domain Sequences for d3ab3c1:

Sequence, based on SEQRES records: (download)

>d3ab3c1 c.37.1.8 (C:47-75,C:202-368) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk
rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln
ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqqrplyhhfttain
tenirlvfrdvkdtilh

Sequence, based on observed residues (ATOM records): (download)

>d3ab3c1 c.37.1.8 (C:47-75,C:202-368) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk
rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln
ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdplyhhfttainteni
rlvfrdvkdtilh

SCOPe Domain Coordinates for d3ab3c1:

Click to download the PDB-style file with coordinates for d3ab3c1.
(The format of our PDB-style files is described here.)

Timeline for d3ab3c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ab3c2