Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) |
Family b.43.2.0: automated matches [227252] (1 protein) not a true family |
Protein automated matches [227032] (5 species) not a true protein |
Species Geobacillus pallidus [TaxId:33936] [225863] (3 PDB entries) |
Domain d3a9ta2: 3a9t A:361-590 [208173] Other proteins in same PDB: d3a9ta1, d3a9tb1, d3a9tc1 automated match to d1fuia1 complexed with foc, mn |
PDB Entry: 3a9t (more details), 2.61 Å
SCOPe Domain Sequences for d3a9ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a9ta2 b.43.2.0 (A:361-590) automated matches {Geobacillus pallidus [TaxId: 33936]} aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl
Timeline for d3a9ta2:
View in 3D Domains from other chains: (mouse over for more information) d3a9tb1, d3a9tb2, d3a9tc1, d3a9tc2 |